PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19666A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 346aa    MW: 37251.3 Da    PI: 6.2992
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19666AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_19666A 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                               788*******************************************97 PP

2Myb_DNA-binding543.9e-1767111147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Oropetium_20150105_19666A  67 RGTFSQEEEDLIIQLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                                899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466894.12E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001676.77E-121761No hitNo description
PROSITE profilePS5129427.23862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.7E-1667111IPR001005SANT/Myb domain
CDDcd001671.54E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPATHKPLA AVDAGGGGGD VVVSASCRAV FCDTELIIPQ PPPPTTPLQQ APLPAEPMLD  180
DGGGVVKLPL VDWTTTAGYL QLQAGCTTFD MVDALALQQQ QQRCGGGGAI PAPLPVVVPS  240
SASCSSTLTS TIMAGDAEHC DNNANNLPWL ELGPNAAGQH VVVDSYAGAL DELRWSEYFD  300
GAFQAAASQQ GALMMQGQCV YGGGNKDDVA VAAQQIDVHG LRNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
1h8a_C2e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365351e-164BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410771e-164BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
GenBankEU9554341e-164EU955434.1 Zea mays clone 1532080 myb-related protein Hv33 mRNA, complete cds.
GenBankKJ7274961e-164KJ727496.1 Zea mays clone pUT5355 MYB transcription factor (MYB156) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465218.11e-135hypothetical protein SORBIDRAFT_01g034270
TrEMBLA0A0A9ASW41e-151A0A0A9ASW4_ARUDO; Uncharacterized protein
STRINGSb01g034270.11e-135(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.16e-76myb domain protein 50